SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro02586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro02586
Domain Number 1 Region: 11-201
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.19e-45
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro02586
Sequence length 210
Comment (Rhodococcus jostii RHA1)
Sequence
MSGQLRIERVVTEGTFALDGGEWNVDNNIWLIGDDTDVVIVDAAHTAQPIIDAVGGRHVN
AVICTHGHNDHVTVAPELAERLHAPVLLHPGDDVLWKMSHPDAKYWHLEDEQRIAIAGTE
IQVIHSPGHSPGSVCLYLPEAGALFSGDTLFSGGPGATGRSYSDFPTIIGSIRDRLFALP
EETLVHTGHGDGTTIGTEAPHLAEWIARGN
Download sequence
Identical sequences J1ZDL4 Q0SDJ5
gi|111019577|ref|YP_702549.1| 101510.RHA1_ro02586 WP_009475279.1.53434 WP_009475279.1.60566 WP_009475279.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]