SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro03031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro03031
Domain Number 1 Region: 92-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.07e-20
Family GntR ligand-binding domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 17-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.2e-17
Family GntR-like transcriptional regulators 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro03031
Sequence length 242
Comment (Rhodococcus jostii RHA1)
Sequence
MSSLISGKVRPPMPLHDKSRRQQLPEEVASYVREMIISGDVRAGDFLRIERIAEAVGVST
TPVREGLLTLRSEGFVELIPRRGFVVAPFTKQDVRDLFWAQAQLAGELAARTAKNITPQQ
VAELEGILQQHQDAIARGDTERIASLGHAFHRKINLTADSPRLARLLGSVVTNLPNRFYA
TIEGHITTTQQEHPVLLEALRKHASKRAKTLMESHILDGADHLIEGLEQRGLWDADDAAN
AG
Download sequence
Identical sequences Q0SCA2
WP_011595700.1.53434 WP_011595700.1.78234 gi|111020020|ref|YP_702992.1| 101510.RHA1_ro03031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]