SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro05586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  101510.RHA1_ro05586
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.59e-28
Family HxlR-like 0.0024
Further Details:      
 
Domain Number 2 Region: 107-212
Classification Level Classification E-value
Superfamily SCP-like 0.00000018
Family Sterol carrier protein, SCP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro05586
Sequence length 214
Comment (Rhodococcus jostii RHA1)
Sequence
MARHAYGQYCGLAHALDIVGQRWALLIVRDLLVGPRRYTDLKQGLPGIPSNILSARLKEL
EDADVIARRALPRPSNAVVYELTDYGNALEDAVKSLGRWGARTLGEPDPDDAVTVDSMVM
ALRSTFHPDVARDVSLTYELRLGPIVLSARIDRGELEVVEGAADRPDLVIETGPAVKALM
AREITPEDAIALGSVSVTGDPALLATFADIFSIP
Download sequence
Identical sequences Q0S520
gi|111022552|ref|YP_705524.1| 101510.RHA1_ro05586 WP_011597745.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]