SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro08022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  101510.RHA1_ro08022
Domain Number - Region: 173-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00573
Family MarR-like transcriptional regulators 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro08022
Sequence length 293
Comment (Rhodococcus jostii RHA1)
Sequence
MNRRSGWLAYWPPDPPEPTMTVARSVADVVTEHVLFEVECIDRMYLNVYVPGLQYAKGLV
GYVHRQLGLPIASTAPLARITDRFTAAEGRALRTETTINNTRDFEIGKRLTHLPALREIG
YTANRRLLRVQQLSHDPITGADALAAITAPVTTATGARVSGLRFADQRSHALLSAVLIFR
LHPNGFTNKDLRTLTAELRGLDPDTVSAGQMTYDLRRLKTRNLIARIEGTHRYQVTDHGL
DTAKFLTCVHDRVLRTGLAELATPTTTPGRLRAAATAYRTAVDTLTATAQLAA
Download sequence
Identical sequences Q0S067
101510.RHA1_ro08022 gi|111024807|ref|YP_707227.1| gi|111024807|ref|YP_707227.1|NC_008269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]