SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro10246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  101510.RHA1_ro10246
Domain Number - Region: 63-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0324
Family Laminin G-like module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro10246
Sequence length 231
Comment (Rhodococcus jostii RHA1)
Sequence
MKIRTLAAIAALTIGAVGVAAGTAQAAPLVTAVPANVQSTGQGVDWTVTRDGNRVLVRIA
SGSLALENNRLVVRNDQGVVVESIPLSLAVDGVAHPVDAHLAGNTAILATNTAPAAATPI
DRNLLLHDVDLPAAVGAVQPPISLTSAIGGFLGAATGLVGGCVLGAIAGGVVSAPAAMLF
GAGPIAGCVGGALLLGSGAGLAGTALGGLGAAVTNVPQFMQVLNQPPAPKK
Download sequence
Identical sequences Q0RW97
WP_011600082.1.78234 gi|111026314|ref|YP_708597.1| gi|111026314|ref|YP_708597.1|NC_008270 101510.RHA1_ro10246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]