SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 101510.RHA1_ro11110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  101510.RHA1_ro11110
Domain Number - Region: 21-130
Classification Level Classification E-value
Superfamily PIN domain-like 0.0824
Family PIN domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 101510.RHA1_ro11110
Sequence length 215
Comment (Rhodococcus jostii RHA1)
Sequence
MLRVHEGPCVYPRRVSAGVLTDANVLYSRTLRDWICLLAFRKSPMFHLTWTEDILAELIY
HIRKKHPHYSDAQVGGIRDRIIAVAPYGRIKGNVIDSDLAYTDDYDAHLHAAAVQYVVTD
DKRFLDFAETNDAILSYEVYTADDFLMLVNQSSPAAVREVLLEQIDYHRRRGGAFNLPAS
LEAAGATHFAQVIRELMRSRAVADALARPLTATAE
Download sequence
Identical sequences Q0RVC9
gi|111026937|ref|YP_708915.1|NC_008271 101510.RHA1_ro11110 gi|111026937|ref|YP_708915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]