SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI14565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI14565
Domain Number 1 Region: 1-111,227-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.7e-47
Family Phosphate binding protein-like 0.0000265
Further Details:      
 
Weak hits

Sequence:  10228.JGI14565
Domain Number - Region: 122-222
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00785
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI14565
Sequence length 332
Comment (Trichoplax adhaerens)
Sequence
KTLIVTTLLSKPFVMKNPKATNEDNLYHGFCIDLLKEIARRLDFKYVIHVESDMIYGAKK
NGTWNGLIGELVEKKADLAFADLTITAEREEVVEFTKPYLNMDATALLKKKNIDEVNRVF
AFTRPFSMNVWISIIISAFIVALYLWLIGRFSPYDWYFDPPPSSTGDESNFSNSLWFVVG
AFMQQGTENTPRSMSCRTIGFFWWLFVLVIISSYTANLAAFMTHSQITTEIQTLKELAHS
SITYGTVRDSQLHEYFKYAELHTYEDMWLKMKANLSNALVETSIEGVEKVQNSTYPYGFI
WDTPYLEYIVNHKDCNLFYLRETFDSKGYGIA
Download sequence
Identical sequences B3RXP6
jgi|Triad1|14565|gw1.5.1166.1 10228.JGI14565 XP_002112358.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]