SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI19492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI19492
Domain Number 1 Region: 6-209
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.1e-50
Family Ypt/Rab-GAP domain of gyp1p 0.00000417
Further Details:      
 
Domain Number 2 Region: 185-309
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.54e-37
Family Ypt/Rab-GAP domain of gyp1p 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI19492
Sequence length 322
Comment (Trichoplax adhaerens)
Sequence
MITIISNTIHKYQLETLRELSWNGVPKSFRPKAWRLLSGYLPVNAERQKLTLERKRDEYC
SYVVKYYPLRNDPSFQETFRQIQIDIPRTNPLVPLFQQPLVQQVFERVLFIWAMRHPASG
YVQGINDLVTPFFIVFLTEYINEVDVETYDIVKLSLKQLELIEADSYWCLTNILDGIQDN
YTFAQPGIQKKVQTLKTLVSRVNGKLHLHLEKHNIEYLQFAFRWMNNILMRELPLRCIIR
LWDTYQAEPNGFADFHLYVCAAFLNHWSKELLERHDFQNLMILLQNTPTDNWTEREIAVL
LAEAFSLKYAFADAPSHFHKKK
Download sequence
Identical sequences B3RIB5
jgi|Triad1|19492|e_gw1.1.1654.1 XP_002108192.1.101920 10228.JGI19492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]