SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI19563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI19563
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI19563
Sequence length 246
Comment (Trichoplax adhaerens)
Sequence
IEETPNGYKLSLRVPEKCFGMIIGKKGSNMKQLQQDTGTKIKLPSSRNSDASNDLTCITG
SSKKGVISAKVRIELLVDSCRSKALPTHFVMVPLLSKQVISSYIQFKDMVLQDFSQCKGI
EESIMQEPQRLHITIVVLRLFDKIEEVNCFVKRLKSIKQAKVDIKGLEIMGDDPSAAKVL
YAEIHDTILQELGEDIVDRFVASGLTGKEGPRLKLHATLMNSRYRTSTPGGTEPFDARNI
LQVREN
Download sequence
Identical sequences B3RIW8
10228.JGI19563 jgi|Triad1|19563|e_gw1.1.491.1 XP_002108465.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]