SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI20754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI20754
Domain Number 1 Region: 15-119
Classification Level Classification E-value
Superfamily POZ domain 5.3e-29
Family Tetramerization domain of potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI20754
Sequence length 182
Comment (Trichoplax adhaerens)
Sequence
MASRNSHDGNRRDLSSWVKLNVGGQYFLTTRMTLCKDENSFLCRLCNNDPDLPSDKDENG
AYMIDRDPRYFRPILNFLRHSKLIIDKDIPLEGVLEEAEFFNMENLVQLTQRRIEARDSK
AKKPSNHVYRVIQCQEAELTHLVSTMSDGWRFEQVINLGSGYTYGNEDQSELLCVVSRDI
RD
Download sequence
Identical sequences B3RPW1
jgi|Triad1|20754|e_gw1.2.320.1 XP_002109545.1.101920 10228.JGI20754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]