SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI21452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI21452
Domain Number 1 Region: 135-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.83e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000471
Further Details:      
 
Domain Number 2 Region: 41-133
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-25
Family Cold shock DNA-binding domain-like 0.0000264
Further Details:      
 
Domain Number 3 Region: 7-41
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000497
Family ECR1 N-terminal domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI21452
Sequence length 236
Comment (Trichoplax adhaerens)
Sequence
MTIFHSCRGHGTYLQDNKLKASVAGFVEKVGKLICVKPVKSRYNGEVGDVVVGIITEVGQ
RRWKVDTYSRLDSLLMLSAVNLPGGELRRRSEKDELMMRQHLTEGDLISAEVQSVHGDGS
LALHTRSLKYGKLIQGTLVTVAPALIKRCKTHFHNLECGASIILGNNGYIWISPLLKEDA
ENQTTKSDTSTLEREIVARLRNCIMALAERQMLLYDTSITYTYEASLNYQVSQHKK
Download sequence
Identical sequences B3RNZ4
jgi|Triad1|21452|e_gw1.2.468.1 10228.JGI21452 XP_002109378.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]