SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI24556 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI24556
Domain Number 1 Region: 32-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-37
Family SPRY domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI24556
Sequence length 365
Comment (Trichoplax adhaerens)
Sequence
MSLTKGGWQRSKIAKAIPPDRISQLYPNVDESLSPLPRAWSPRERCQFIILSQDNLRVQY
RGNNTNKPHKDAASVRATYPISPACGIYYYEVKIVSKGKDGYIGIGLSVHNSNLNRLPGW
EKHTFGYHGDDGHSFNSQSQGDPYGPTFTTGDVIGCGINFIHNTCFYTKNGRNLGMINFC
TTLRHDLYPTVGMQTNGEIVDTNFGQEPFLYNIEDEIQETRMKVSQSVLSTPITSEGNSV
QAMLHKVIIDYLVHHGYSATCETFATITGQSYKEETASIENRQKIQALIMDGKISEAICL
TEKNYPTILSNKPWLHIRLLVRQFIEAINGSDTVSCSSANSTSANSINTNNNTLASSSNN
DISQG
Download sequence
Identical sequences B3RV98
jgi|Triad1|24556|e_gw1.4.823.1 10228.JGI24556 XP_002111989.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]