SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI25991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI25991
Domain Number 1 Region: 13-109
Classification Level Classification E-value
Superfamily POZ domain 2.16e-28
Family Tetramerization domain of potassium channels 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI25991
Sequence length 230
Comment (Trichoplax adhaerens)
Sequence
MQVNQVSSEQFPSIIDLNVGGQLYTTSLSILVKDPKSLLGAMFSGRQRIARDARGRYFID
RDGALFRYVLDYLRNSKLCLPEEFIERERLLCEAEYYKIEGLIEALREKTNIGRQKGILS
LSYRGTYAFGRDGLADVKFRKIHRILVCGNVTLTREVFEDTLNETRDPDRSDNSYSSRFY
LKHGHLEKAFDLLAEKGFDLIASHAGGAGHDGESDETKWNHFIEYIFQRK
Download sequence
Identical sequences B3RY70
10228.JGI25991 jgi|Triad1|25991|e_gw1.5.445.1 XP_002112873.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]