SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI28500 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI28500
Domain Number 1 Region: 40-207
Classification Level Classification E-value
Superfamily EF-hand 2.53e-33
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI28500
Sequence length 208
Comment (Trichoplax adhaerens)
Sequence
MAATSRHEAELKRKCQTALSKTQDPVEQLRLQCLSRGSSGIKGLGRVFRIMDDNGDKQLN
FAEFKKGLRDYGVIVDDTDARKMFEAFDTDHSESLDFDEFLKALRPPMSTKRKKVIFEAF
RKLDKTGDSVITIDDLKGVYNPRKHKKYMNGEWTEEQVFRSFLDSFDSPDDPDGRVTHEE
FLNYYSGVSASIDSDAYFDLMMRNAWKL
Download sequence
Identical sequences B3S3S6
jgi|Triad1|28500|e_gw1.9.510.1 XP_002114877.1.101920 10228.JGI28500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]