SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI32414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI32414
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.78e-85
Family Calponin-homology domain, CH-domain 0.0000137
Further Details:      
 
Domain Number 2 Region: 274-393
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-32
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 3 Region: 1308-1463
Classification Level Classification E-value
Superfamily Spectrin repeat 8.2e-29
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 586-723
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-25
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 5 Region: 1522-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-25
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 6 Region: 394-508
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 7 Region: 1203-1327
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-21
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 8 Region: 1839-1991
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-21
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 1679-1783
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 507-623
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-17
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 11 Region: 2119-2205
Classification Level Classification E-value
Superfamily PH domain-like 1.58e-17
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 
Domain Number 12 Region: 798-933
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 1044-1146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 14 Region: 904-1039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000824
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 15 Region: 727-828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000208
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 16 Region: 1988-2060
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000832
Family Spectrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI32414
Sequence length 2211
Comment (Trichoplax adhaerens)
Sequence
MSNLQDSDAARAGHFEKSRIKALASEREKIQKKTFTKWMNSYLNRVSINVNDLYTDVTDG
VVLIRLLEVLSGEKVAKPARGKMRIHRIQNVNAALKFLKNKHVKLENMGAEDIIDSNNRL
ILGLIWTIILRFQIQDIQIDDGSGSAEHKSAKDALLMWCKLKTASYDNVKMTNFTSSWRD
GLAFNAIIHKHRPDAIKYDSLSVNSPLQNLRNAFKVAEESFGIPQLLDAEDVNVEYPDEK
SIMTYVASYYHTFSKMKAEDVVGRRIGKVMGEVIENEALMQEYDTLASNLLDWVQDKIAK
LSDRTFDNKLSGVQQQLVQFNTYRTTEKPPKFQEKADLEEKLFTIQSKLRANNQKAYTPK
EGKTISEINKAWGKLEKAEHERELALRQEILRLERLEQLAAQFDRKARLRTQWLTDNRGI
LGGEDFGDSLPAVEAAVKKHEAIETDINSYHERVVAVENVANELTEQNYHDSDRIQAKKD
NVLELWNDLIEMIKQRRNDLEQHLQLQKILQELEDMIDWTKETKALLQSEDYGKELQDVN
NLLQNHSILESDIVVHADRIKNVIAEAEAFEAPEDENGKSMKFRCKNIHDGVDQLGQALN
EVQQLAADRKSKLEDSQRLLQFYQDCEDEQNWMKEKEQTLELSNLKKVQDYVSLTLLDHR
QKALEAEVNGHQPVIENILKVGRGMIDNGHYASSTISNNVDNLQERWENVTDILAKRQRR
IDEMLVLQQLLVEADNIEAWITLHVSLMSIDNYGVDQGSVESLMKTHLDLSNEIRAYREQ
IDGLESTSEQLAPQDRASDDVVERKFRISKNYDLLLQLLSKREERLKEMQLFYKYQDENE
ILLSWVGDRVAILESIEAPNDMSEADLLSRQFEGINKEVNTNQERYQKVGSDGQELIDNQ
NSNSDEIRASIERLNGKWKQLVVLIAVKKEIIDNKKRLLDFFYEIDETKNWVIQKGSGLD
NELSSTADPNVIMQLQRQINAVERDTPAVEERLHAIEAKKAQLIEEQEDYETMLNDRVSE
LYQNWNNVLDKANKQRNTLGECSDYQKLLFDMDDLHDWIKTQQIYASSDDIANTLSGAEK
LAKEHEELTYDVQSRQMIYNNILSVAPQYYTDDTTGRRLRQRVDEIVQEWEELLQACEKR
KLLLKQNYEHMLFQRDVKQLEGSLSKQDMFLTKARQKKLSLFNIIELVKRHKEYKKNLEL
CSDKVAHVKRFARRMSENDHYASDKLVAKSLAIEERLNDNYGKFNDAEVKLQQAVQLQQF
HQQCNELNDWISEKQQLANDEAYRDPTNLTGKLQKHQTFEAELVATKDQLDSIKDVGQTI
IDNHSEAESEVDDRIAELQNEWLKLCQASANKGRMLNEVYNQVQFSRSVADLEVWLDHIQ
SILTVEDTGKDLITCTNLINQQMGIENDIAARKDRIDQLEKQVQKFQEADHYDAENMHEK
YNNVKQRYNDLDEPCKEKRKKLEAARRFFQFFRDVDDETRWLEEKILQAKSEEVGTSLSE
VHNYKVSHQNLCNEITSHEQILNSIYQSGEALIAEGHPSADDIQNSIALMKDKFVLLEQY
CKERESLLDKYYKAHQHLFEIDEAESWMIDKVAVLTSDDRPKDEDSALTMMKNHNNLQSS
IKDYRNHLEELRNGADDLVQEELFISEDIRDAMEDADNRFTQLKILADERRDRLNEIIKL
YQFNREVDDLELWLGDCETIAKSKECGADYEHLEIIQDAFEKWVDNTKTTGTDRIRQVNT
MADQLISTGHSESATISEWKNGINELWEVLMKLINGRFELLEGTRELYKYYYDLNELQQH
ILHKDQILPSDLGRDYNSTSAFYRKHDSFQHDLVGLEVKINGLRQQSKNLAAEHQSNGEE
EKIKKCMDDVKACWKAINDKSNWRRSQLLQTLDLFKLIVIIDDLIMWITDVYDEIHNLEE
PEDVPSGERVIASLKNIKEEIESYEERFNTAKEKGDTLIERDNYAKKEITVRMEALLNVY
ADLKVEWEMYYREYDIYLKAFKFEEDMNKGDSWLTNCEASPIEMDLNNLSNLEDIIKKQS
ELQIALAAQRDRFKKMMELTDFERREMDEVGKEMEKREEVTRKLHIQQFREYLQDKEDMM
CDEDVEPLPEAEDEPKEEEPIMMGTLHRKHETEAGGKKADKRSWDKYFVVLNGTNLIFYK
DRKQFQNVRILVSIKSNAPEISITGCQCGMAIDYKKKKNVFRFKYVEINIK
Download sequence
Identical sequences B3SAT8
10228.JGI32414 jgi|Triad1|32414|e_gw1.23.5.1 XP_002117370.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]