SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI34476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI34476
Domain Number 1 Region: 87-162
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.44e-32
Family Skp1 dimerisation domain-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 11-72
Classification Level Classification E-value
Superfamily POZ domain 2.88e-17
Family BTB/POZ domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI34476
Sequence length 165
Comment (Trichoplax adhaerens)
Sequence
MDNKGNDSKDIIILRSSDGFEHKVDIKVAKMSATIKTMLEGKLNEAVPLQNVNNAILELV
VKWAEHHKDDPPPPDDDDIREKRTDDIDPWDQEFLKVDQGTLFEIILAANYLDIKGLLDS
ACKTVANMIKGKTPEEIRRTFNIKNDFTPEEEAQVRKENEWCEEK
Download sequence
Identical sequences B3SEF0
jgi|Triad1|34476|e_gw1.249.5.1 XP_002118619.1.101920 10228.JGI34476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]