SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI37956 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI37956
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily POZ domain 1.7e-35
Family BTB/POZ domain 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI37956
Sequence length 118
Comment (Trichoplax adhaerens)
Sequence
MAEIDKRSESSLQIGGCEGPEAMYVKLIANDGHEFIIKREFALTSGTIKAMLSGPGQFSE
NETNEIRFRDIPSHVLSKVCTYFTYKVKYTNSGNEIPEFVIQPEIALELLMAANFLDC
Download sequence
Identical sequences B3S185
XP_002114107.1.101920 10228.JGI37956 jgi|Triad1|37956|estExt_Genewise1Plus.C_70415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]