SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51770
Domain Number 1 Region: 177-259
Classification Level Classification E-value
Superfamily Kringle-like 3e-26
Family Kringle modules 0.00071
Further Details:      
 
Domain Number 2 Region: 274-374
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-23
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00065
Further Details:      
 
Domain Number 3 Region: 59-175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-20
Family MAM domain 0.016
Further Details:      
 
Domain Number 4 Region: 393-493
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 5 Region: 501-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000101
Family MAM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51770
Sequence length 770
Comment (Trichoplax adhaerens)
Sequence
MTYAGGHKYQALTPLIGLGVPVQHQVLGLDRNLITHLKTIYDKQLQTVYGILYILSLSGS
GHYLYIEASAPRTKGDFADLLSPPLYTPRNVYTVNVRFDYNMHGDGIGSLEVYVIYAKYN
FTEKLLNVKQGNQGSHWLTHHLQFHPQYNEYHIFFRGIIGDNYKSDIAIDDIAVYVQEIN
CVTGNGRFFRGTNSFTKSGLTCLAWNSLARFNPRLYPMDDLKRNYCRNPGGLRSRPWCYV
TSGSSNGSWEYCGVTQCLPSSIKQLSGYPGGHRIPVKLVGGQANYGRVVVYQYGQWGTVC
NQNFGTASATTICRQLGLPTPGYRLKHSISSGSGRIWIERLDCFSYSKDLSECTISWNSS
YCIHQEDVGVRCGPLNDNKSISTVTPINKAPISVELLGGSSNEGIVVVNLNGSKGIICDL
DWNIKTADVVCRTLGFVGAKRSYGKYFPKRTWRTLLTSISCNGYESSFRQCGYSIQPGVN
SCNTKVAASVTCETDSSDAAMKCDFSNGFCQWKNLITNDLKWLWHKNGYHFSPIFSNNDM
SFIYLTLAMQKTKSDGRATLLSPRLRKSSTVQMFFKYLNTGSGVKKLIIEYLDDNAFTHN
INTIQLGSFQNDVWIQRAFSFYPPGKSFQIRIVAVYDTADNTNGGAILIEKINLSGCSPY
TRKSITIVALITIAGSVGLVLTIVVAFIRIRRRYSSARNRSTNIPAGLYDRIHQSLATSN
SNASLPAYCPTTPIGHQSFAVHDQPTIIQGQQIRILELSYGCQKITSGKS
Download sequence
Identical sequences B3RKU5
XP_002107849.1.101920 jgi|Triad1|51770|fgeneshTA2_pg.C_scaffold_1000517 10228.JGI51770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]