SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51771 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51771
Domain Number 1 Region: 221-326
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 2 Region: 56-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000475
Family MAM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51771
Sequence length 458
Comment (Trichoplax adhaerens)
Sequence
MRKKFRFTVESLCLIYVLLLLNQISTYGAYHSKEKRSTLWNPASAKIYNFSAIPLASIKC
NLQNDLCGWKEVTGISNFGWKRQNGLEADASGHGLSNDFTYGNKSGYYLIANFRNFLKPN
YFADLISPPMLLPKQLQHVKVKFAYNTDISTLQIYAIYPRYNLTQHRLRESIFKNHSHQW
YQEDFTFLPLYPYYQIIIRSITNAKNILIALDDLEIYPIDTIPIKLVGESSTSGRVVVYH
EGEWGTVCNDLMNDRVATVICRQLGLPQPGKMLSTINEGTGTIWIRLLICIGNEKRLENC
LISSWNSTFCNHSEDAVISCSGKTLTTTSAVGYTATVATTKPSESRTAVPFVLISASFFV
LVILTLIYIRNARRSISRRNQSTRQSATQRPRMVAPPSYNTALNEITRDPNALKELHHSP
TGALLQTEGCNKKRQKNSPPHLGDKKYFISLPTHFNET
Download sequence
Identical sequences B3RKU6
XP_002107850.1.101920 jgi|Triad1|51771|fgeneshTA2_pg.C_scaffold_1000518 10228.JGI51771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]