SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51898
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily Kringle-like 4.45e-32
Family Kringle modules 0.00024
Further Details:      
 
Domain Number 2 Region: 206-302
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 3 Region: 309-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000269
Family MAM domain 0.0061
Further Details:      
 
Weak hits

Sequence:  10228.JGI51898
Domain Number - Region: 13-92
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00285
Family MAM domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51898
Sequence length 566
Comment (Trichoplax adhaerens)
Sequence
MIRVIFFMEFIQVLMYFKLYGSGVDELAIFSGLYTNQYKDVWLTTTKSSASSWRKADFHF
TPRQRRTRIILDGVLGRGHGGQIEVDYILIAPYEVNCYTGNGVYYRGSITKTISGYNCQQ
WKSNSPHNHSYSPSKYPDDDLSYNYCRNPGGKSSRPWCYTTNSQKVSEYCNIPSCYGGST
TTSYPLRTTTKSLGTQMQITESVQLSNYLSGVVEIKAHGVWGYMCAENLSNNTANVLCRQ
MGYYVSSRHYPGSPLNPQSSYQVASYNCTGLESSIEHCPSLRNTNGSYICNNPQSVAVVA
CEQSSGNTTSCKFDKGFCGWSQPQRNLRMDWTWQSNYIFPGTNFKKSDPSIVVSTRNGFY
LDKAILRSPQQSFQSSIVTIRFKYYLSSSGSVLTLKVDENNKIIKKMSHDTNGAWISVYT
EVLPSVKTFTISFVVMKTSSESVIVGLDDISIVGITPEPFVRKCIRATVATALILGCILL
MICQICKKKPLRTIADENPPTYDQIVPPEDESPTEHDIIPDELTTNRINDNMEREQVRSC
PRNGTADRSIISPNTVRSRESLTAEV
Download sequence
Identical sequences B3RL69
10228.JGI51898 XP_002108699.1.101920 jgi|Triad1|51898|fgeneshTA2_pg.C_scaffold_1000645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]