SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51899
Domain Number 1 Region: 122-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000206
Family MAM domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51899
Sequence length 194
Comment (Trichoplax adhaerens)
Sequence
MINYDEKVDRPSLHGFSFSCPDTVRNSQHQRCQNHGNQVLLCDTLDAALRKKNEWTGFNQ
IILKDTTLDCHDCKLQRIVEWKNQPSHSLIGRCRLSENQLLNLQLLRKSDLRCRKIDSGT
IAAACDFRSNFCKFSQEKSSDDLDWARVSGTKHDGTTGHYAYLASSQSLSNHFAQLLSPV
VELPNNVQEFRVSF
Download sequence
Identical sequences B3RL70
10228.JGI51899 XP_002108700.1.101920 jgi|Triad1|51899|fgeneshTA2_pg.C_scaffold_1000646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]