SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51906
Domain Number 1 Region: 87-190
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0058
Further Details:      
 
Domain Number 2 Region: 200-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000135
Family MAM domain 0.021
Further Details:      
 
Domain Number 3 Region: 13-63
Classification Level Classification E-value
Superfamily SRCR-like 0.0000116
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51906
Sequence length 531
Comment (Trichoplax adhaerens)
Sequence
MKIFILLGGNVEGQGPIWLQGHDIKCPPTAIDLAQCTLGPWDVNNTCTHAYDLYVSCNPS
PIVTYQTTASTTLIETVAPPLPRNKYKLAIKDGFDITSGFVNVLYNKRNGVICSKNWNMN
DADVVCRQLGFLNALSANASITQYAIRHEWITELNCKGYESTIDACPIQDSSVIRNCSTT
DIATISCNQEKQQFTSRNRPTYCIYDDGFCGWKISGNMSWIWHSATGNHYHPIAGAISYA
YVIRPYHQTSMGKAVMTSPVLTARSGQVVEISFRYYIVNLAVSNLEIRYNEDGNTGITIF
DNQINTSNKWTQMKTTGFTPKGNHFRLKIIYSASRTFGPSFVSILAIDDTVITGVENDGY
QSNDISIIGAAVAGGLACIIFLMVAICYYKKSKTKIIRDVSVPNEYVASTSRQIRNFQRA
NSELLINNQLPRTPVNSNISDSNTAISPVVVRTPSVTLSVTSPMSDHQSRSEDRFSDVTV
TSSIEDGQQSRIGIALSPKRRDIICKLNIGHPPWYKALGTFILHNATIFRN
Download sequence
Identical sequences B3RL77
jgi|Triad1|51906|fgeneshTA2_pg.C_scaffold_1000653 XP_002107917.1.101920 10228.JGI51906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]