SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51908 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51908
Domain Number 1 Region: 153-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-31
Family MAM domain 0.0018
Further Details:      
 
Domain Number 2 Region: 315-409
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-24
Family Kringle modules 0.00051
Further Details:      
 
Domain Number 3 Region: 423-522
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51908
Sequence length 544
Comment (Trichoplax adhaerens)
Sequence
MASKAIAILYVTLVYLSFTIIATYGDQVAVKESKDDCPSNCKCENDQVRCSHFILNQDLQ
LPEKTKLLIFENAVSCEDEHLHNLLPLALSKQIKISGQCSKPKRLIGSSLAELIAEKLSS
TNHLRDKRSNFATPSIYNFTVSFVIILETPQATAGCTFDEGMCGWVQLSNVDFFDWTRHS
GSTPSSYTGPRYDHTSNSTEGFYIYTETSRPRVLGEYADLMSPPMLAATSSSTVEVKFYY
HAYGSSLGKLQLYAMYPSVSQAFYSITNVSLYSVNQWRPFSTTFQPLYNPYRIIIRGTVG
QSYTGDNAIDDIFISSVENNCYVPFSEVYRGINSQTTSGSYCRSWASSTAQYYNHTPSNY
PYSDLGFSYCRNPGGERSRPWCYVSTGSTWDYCNIPRCIAPTTTRAQYPLGRRYPVALIN
FDHGQHYIGRVAIYHDGEWGTIYGRSLSHSFIGLLCKQAGLGNYGLRYYGAGYGIAGVGK
VWLDYTRIACPASSNSINNCTLGSWGSTYGHSSDLWLTCSWHSTNTTANPAVSTCWSLLV
ILIL
Download sequence
Identical sequences B3RL79
jgi|Triad1|51908|fgeneshTA2_pg.C_scaffold_1000655 10228.JGI51908 XP_002107919.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]