SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51917
Domain Number 1 Region: 113-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-30
Family MAM domain 0.0019
Further Details:      
 
Domain Number 2 Region: 271-363
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-26
Family Kringle modules 0.00036
Further Details:      
 
Domain Number 3 Region: 615-787
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000855
Family MAM domain 0.018
Further Details:      
 
Domain Number 4 Region: 385-483
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000249
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0068
Further Details:      
 
Domain Number 5 Region: 498-591
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000392
Family Scavenger receptor cysteine-rich (SRCR) domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51917
Sequence length 836
Comment (Trichoplax adhaerens)
Sequence
MQCLSGCQCLDKNVAICSSLPENFDKEHRNIKKIILIRPNCNCQFARWYRWIEWKEIDVE
GACYQPSQFLNIPVQSIHLEALICPQDSPERYCFHVKLSPNITDSTTYPVDAIGCDFQKG
LCGFRQIRNADSIDWDLKSGPTTYSMVTGPLSDHTYGTATGKYLYMNSLPNPQNSVAEII
SPPLIIADQVKTVNIIFYYQLYGRDIGGIRLYAIYSKYSLTKYQIWERKYNRGPYWRKAD
IMFNPQYPEYQIIFQAIDGGTYSDIAIDDIYISPFEEDCYSGSNYGIYYRGTTSTTQAGI
ICQSWFTVFPHQSNFSSTFENQLEVNYCRNPGGSKSKPWCYTINASIQWQYCDLSQCPPR
LPIKPTSLPGDSKFASTLPISIGPNGLLAFFRGSVWGTICISSDWGYTVSTVICKQKGIS
ISGITKAIKLNKAYEGDPSWYYPIECTGLEDSLEQCKSNVSDAKGLVSCDDNYAIGVDCL
QPTTGWPTHDPIEYYSVLAGGKSLREGYLQVYSGSSNSFTTVCSTLNNSLPLDIPDVMCR
EQGFLYALSTEAELIELVIWPRKSWIYDLHCTGYEHKIYRCQQMKYDNVDLGPKCERRNK
LITAKCKADESDLNTLDPSCDFEKGFCGWNYKHRIPFTNLAYWVYKDDSEGHYLPIPDLA
GNFIYTIQGPFWTSGSSAALASPLLQIANDANLVASISFKYYVYGRNFQKIEVLIKNGSQ
EGASTKTLWSQELTVQQISGWIPQTLPLQSSTDFSILIVAYSKYIDYNPNPTPPLSAIAL
DDIKFTNIIKKNDRTDPIPIILVTLGLLTIIVALFVIVGYVSKKETKRSVVVTNDK
Download sequence
Identical sequences B3RL85
10228.JGI51917 XP_002108703.1.101920 jgi|Triad1|51917|fgeneshTA2_pg.C_scaffold_1000664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]