SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI51918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI51918
Domain Number 1 Region: 198-289
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-22
Family Kringle modules 0.0016
Further Details:      
 
Domain Number 2 Region: 9-195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-18
Family MAM domain 0.014
Further Details:      
 
Domain Number 3 Region: 296-392
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000798
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0051
Further Details:      
 
Domain Number 4 Region: 410-570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000068
Family MAM domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI51918
Sequence length 581
Comment (Trichoplax adhaerens)
Sequence
MIYIGPPISSTSCDFEKDNCQWIDLVGMSAFFWRRNQTQMPTSKFSPIADHIYQNECDII
IPVLWYLIILSVLEDRGFFLLIQNLDYKISGEVAEILSPPLFLPLRINNAIIKFYFSMYG
PGVGSLLVYAIYPRYDKDLPRHLLWERTGSIHDQNWHKKTISFTPKYWEYQIVIRGTIGI
SLHGSIGLDDLTVHPEELHCFTDRGQYYSGTSSFTANRTMCKYWNDTMIYNKLFKERENN
DESLQNNYCRNPELLHARPWCYIDSSTLQWGYCNISSCNNPSNFNTMTSIRKGGMLVRLI
ERFNFARVVVYHEGQWRAICSELFDIPAASVICRQSGLPTPGYPREFNSNIGSPCLRNFR
CTGLEGNFSQCTTFDRDGTPYEYSRYQTGVICGTEKKFEMAYDFSEVPLTSTSCDFEYGF
CGWHHVFGTNSTMWYRNKIEGKYHDYQSGTMKSQNDGHGWRLVNGRKNTSDTRGLAEISS
PSMILPTEAQAVFLEFYLKRFGSGTRTLRVFVVYPRYDSSLSYHSLLIDGTLYKNWYKVT
KVFQPQFPGYQIIIRSEDFGIAIDDIFIYPLGMEVLHQCNF
Download sequence
Identical sequences B3RL86
10228.JGI51918 XP_002108704.1.101920 jgi|Triad1|51918|fgeneshTA2_pg.C_scaffold_1000665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]