SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI52003
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily SNARE-like 1.28e-43
Family Clathrin coat assembly domain 0.000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52003
Sequence length 142
Comment (Trichoplax adhaerens)
Sequence
MIRFIFIQNRAGKTRLAKWYMHFEDEEKQKLIEEVHALVTVRDAKHTNFVEFRNYKIVYR
RYAGLYFCLCVDIADNSLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQSKVLKQLLTLQTYD
Download sequence
Identical sequences B3RLH6
XP_002107977.1.101920 jgi|Triad1|52003|fgeneshTA2_pg.C_scaffold_1000750 10228.JGI52003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]