SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI52048
Domain Number 1 Region: 9-174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-20
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 2 Region: 560-739
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000561
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 187-314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000106
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 4 Region: 761-915
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000396
Family Laminin G-like module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52048
Sequence length 1166
Comment (Trichoplax adhaerens)
Sequence
MAYFNCNYFTLIGATAFDGRNYMAVNITDHADNMTLQFQIKSNQIDGQLFLLPISGNSSY
LSIQIKSGYLKALWIIHDESLGLNSMELNNGVLISNHQPHMVNLYRLGENFILQVDSFLS
HSQHLLAPFNRYSIHGIAYIGGTPSEIQTRFNLTQNFIGCMHNITFSQNNANLFVKEKVI
IGNLSQLSCQNQDIQLAYLSKSQSSIQFMEQIYNQSAEYNLTFVFRASYSQQTQLLYITE
TQSMHMLRLFINNKVIFVDVSNFAPLPAVINRDIFDGYWHHLSVILNRTHCRVILDNEET
TLTSLQPIDNQNKTQNRTVTIQFHGSLPIIMRVPDANNVENFIIHKYIDRYQQSCYDIFR
LQESKADGWYNIDPDGPNGLLQPFPTFCSRSDLTITTIRHQFGTNPYNVPQNNSIGPGAR
VIDITYQDGIGIQLQNISISQITALINNSNTCGQVLNYFCSRSVLLNYPHQPYVWWVSRH
GQAMNSWSGAPIGSRKCACGTVDSCINKTKVCNCDANRQTWASDEGTLTSKAHLPVTQVH
VGYQSNDIQRQSLIQLGSLTCDGQAPPSDIITLTSNRHGIALNRQQLSDGHIRISFKGKS
VYGILLFLQGLSTRVVLTVSPKQVNLTYDLGQGHGQQQLSVAAEGYNLYNDDNWHQIRFS
LSLSGSWLSVDQATSFEKKGVTSTIHQLIRFDLSGILSIGYNSAMNMDGFTGCLGDFFIG
LKKYSLQQYIGNTIVNSCKIPCFKTPCQHFSVCQGNYSSFYCDCSSTQYIGPVCSHIRGA
QFSNGNGIRYTNSEFNPSDNRIFLSFWTNLSHIDILNLKLSIENSPQSELILAIDNSRIL
LVVNDSNIILNELNRVKYNDQQRHDVLIDLERNLISVDGKEVQDVVKLSLHNNITIQLGD
GNNGLGGLCLNNVSILGLRLLDLAYQSPKSQNIEFIPNQSRHEVKEAICINGQILPTTTS
TTLTKSTTHFTNKIPSTTKIPSTNKPISKASNAAPTTSSKQSTTSSSQQIFTSGLGTGSV
PFVNTIGTALTGSQQSMTIGIVAGVVSFILVVIIIVVLYWYYVLRPKKEKSIELTHMDKE
IIENTDQPDQIVGSTSDQSNHVSKRQSQSITKITPRNSNCYDNDNDNLDVNNLCNDHLEE
INLMDGDTLEKHEQHDDSVQPNRSND
Download sequence
Identical sequences B3RLL8
10228.JGI52048 jgi|Triad1|52048|fgeneshTA2_pg.C_scaffold_1000795 XP_002108753.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]