SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI52060
Domain Number 1 Region: 34-136
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 2 Region: 142-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000396
Family MAM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52060
Sequence length 409
Comment (Trichoplax adhaerens)
Sequence
MNNKFRYLIFLIIVLYGNNIRVFSGNVPGIAVSPIRIVDGFTQYSGRIEIYHANKWGSIC
SNGWGIKEANVACRQLNYAKAMSAKASLRQESLSKQSWTGFIACQGNEIALSQCEQSQWI
ISAECTSQSNARISCEATADNPLNCIFEHGFCSWKQPKRNYKMDWLWTDSNHTPLNKKFS
GPHIFLNTLYGNDEEEATLRSPLLMTPYQRNITVTFNYHQSKIISGAFTVEVFTKVSQKI
WQADKASPPDDIQQRKVVFQAPAKHFNVQFKFVKGRKSTGVISMNAIKIQGCREASKAIY
DEDDDSMAMGFGLAALVFGPVVIFFCWRYHTKKQDEIAEANTLAKQVRTHQNQTSQPRIR
NSSGGNPTESLQPLLKENATDDRQDYSTSQKLHDSESQDEADEAASWLE
Download sequence
Identical sequences B3RLN0
jgi|Triad1|52060|fgeneshTA2_pg.C_scaffold_1000807 10228.JGI52060 XP_002108013.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]