SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI52061
Domain Number 1 Region: 181-326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000301
Family MAM domain 0.0053
Further Details:      
 
Weak hits

Sequence:  10228.JGI52061
Domain Number - Region: 134-175
Classification Level Classification E-value
Superfamily SRCR-like 0.0183
Family Scavenger receptor cysteine-rich (SRCR) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52061
Sequence length 496
Comment (Trichoplax adhaerens)
Sequence
MSKREKYLLLILIIYISNIVRIHSFLTLNALNGSDHECIDRCTCNFNNNQMKCKLEDLPT
TDIPSGITQIIITDGHLRCDCSIAHIIRWAQENKVGLEGKCNSPTRYKDKNLSDINLSVL
VASCNKGSDFELEVNQIAWRLDGNCTGLESRLSDCNIQIDDVADDCPIATVKCLEDEGGD
PTNCNFQKGFCGWSKINSDYLSWIWLNNNHNHEGYQVLVSLTNHTKSQSAVSLQSPVLKP
LKNKVQVYVEYYFSGIIDAQLLLQIQLEYDDEYTTLYSLNMEEHNWNNASVTITMNHNNF
RIRFTVKNGQNSDGEIGIGQIKLTDCKLRDDEENRPNNRFVIIVVVICAITIFPPSIFIY
AYVVKSRSENGPEIQINLPCSSTCKILSTVCYCCGPRSSNTFEILEETNANYEAPNYETV
EPPIRSESPPIFPPDFQESLDNLHHDAPPPYYQTLTENSNMNSNNDIQLSLITLEIANSE
RNLLPSYDSVIASERS
Download sequence
Identical sequences B3RLN1
jgi|Triad1|52061|fgeneshTA2_pg.C_scaffold_1000808 10228.JGI52061 XP_002108014.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]