SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52313 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI52313
Domain Number - Region: 95-209
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0337
Family p120GAP domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52313
Sequence length 252
Comment (Trichoplax adhaerens)
Sequence
MTRYIFNETSEVPRTTVKEHLNDINNMLDSGMDKINMKKYLTYLKYKMQGLQFSQINLTM
YRSWLYDNKPLQPTQFRSILFIGSKFGSTRDWNRLLTRYLDTRGNWKKAIMQEALAATTK
KFLISKLLKTAINNKKVNNNRLKAILAAVSQHFVNRKIIWNFFTKHWKVLNQRFSYQPNA
LRIILRDITKKFYTQEELQMVIKFFQNRRLRYGERDVSKSIDLIAGRVHWKKHFQNFLKR
KDIGIITPFDKN
Download sequence
Identical sequences B3RHY1
jgi|Triad1|52313|fgeneshTA2_pg.C_scaffold_1001060 10228.JGI52313 XP_002108143.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]