SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI52902 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI52902
Domain Number 1 Region: 19-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-18
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI52902
Sequence length 147
Comment (Trichoplax adhaerens)
Sequence
MAVTLPLLVLFVLFSNANAACNKSFTLSSDTFATENFPNRNFTGYCHYQIKLPFRRAIDL
QWLAFDVGSPKVNSKCPDNYVTVSDGAFPQIQHTYTFCGKQPQNITSKTNILSIILYVNS
NCSHQGFRVKYTSRIELSTFTPNVKVA
Download sequence
Identical sequences B3RMS1
jgi|Triad1|52902|fgeneshTA2_pg.C_scaffold_2000059 10228.JGI52902 XP_002109159.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]