SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53121 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53121
Domain Number 1 Region: 12-133
Classification Level Classification E-value
Superfamily MAPEG domain-like 2.22e-29
Family MAPEG domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53121
Sequence length 140
Comment (Trichoplax adhaerens)
Sequence
MDEQNQLLSFSNPVFNAYAFYAVIIVLKVLTMAVNTGRLRQKNTAFSNPEDAILFGIEPS
KKNVNVKHPDVERFVRAHRNDLENIISFLFVGFLYVLTDPPYDISIYCFRIFTLARIIHS
VSSVKVNTLLRYAAAIPGME
Download sequence
Identical sequences B3RND1
jgi|Triad1|53121|fgeneshTA2_pg.C_scaffold_2000278 10228.JGI53121 XP_002109267.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]