SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53234 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53234
Domain Number 1 Region: 289-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-44
Family MAM domain 0.0015
Further Details:      
 
Domain Number 2 Region: 124-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-34
Family MAM domain 0.016
Further Details:      
 
Domain Number 3 Region: 529-667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-16
Family MAM domain 0.0053
Further Details:      
 
Domain Number 4 Region: 488-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000148
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 449-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  10228.JGI53234
Domain Number - Region: 667-699
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00981
Family MAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53234
Sequence length 715
Comment (Trichoplax adhaerens)
Sequence
MLRRSLHSYTKLVILICVFGWTSTNVNPRARDTSDACLLSGKKHHFSTGCLVLESLNIIH
QPTQESEEISKAAILTKLIDTCQLREKNITKMLRHSPSFFMELTILIFIFAWASISGAEA
FTEVDLSCNFERNFCQWESGRRTDSKFAWIRNKGETITSKTGPSYDHTYQNPNRGYYAYL
ETSNPLYNRATLESPVIRSNHSHCLRFWYNMNGADVSRLQVVSSTLEILWSKEHNHGNIW
LLAEVDIFLRVQQYKISITGYAGNSYEADIAIDDITWEKGLCKNTEFDNLKCNFESGYCG
WTNVGFDNFDWTRRSGSTYSINTGPDYDHTLQTPNGYYAYMEASDRHAGEKVILVSRVLN
NKRPICFSFWYHMHGKRVGKLLIKVVTKNSTEVLWVKEGSQGQDWKEAKINITTIPREYQ
IHIVAVCGLDWSSDIAIDDIEINEGSCGIHPCNQNPCKNGRCNIISSVSYTCDCWIGYEG
KHCEIFKGYKACESNPCLSGTCVSLANGRRYKCQCPPGFTGAQCLRISNWTCDFKKDFCS
WEQSDLDTLDWEFAELENRDRYLSLFNRDGSNGFAIIKSPLLQGNDKLCFKFSYLIVGNT
TSLAVTTSFNGKIWSKDGGRINTWRKAAITIDKVDRYVLFKIYITALRRRGDGRIALDDV
QLLPGKCPNLDCNFQDDFCAWNNAFFDDFDWGRRSGPVTTTSIGAKTSTKLRPGA
Download sequence
Identical sequences B3RNN9
10228.JGI53234 jgi|Triad1|53234|fgeneshTA2_pg.C_scaffold_2000391 XP_002109325.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]