SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53235
Domain Number 1 Region: 105-378
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-71
Family Eukaryotic proteases 0.00027
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000109
Family MAM domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53235
Sequence length 379
Comment (Trichoplax adhaerens)
Sequence
METNRAVLVSPDMKSSGNRFELTFSYHMYTYVVGTLSISTTYNGVIWTKSGSQSVSWLSE
KIPINVPKGQEYQIHISATAGYANLAIDDIIWRKDQRAEEIQSIRAIPNHPRCGIANSIP
RIVGGSVASPHSVPWQALLTVHTTIGNLRRRSTCGGSLINENWLITASHCVSNKPFLVDI
EFGRHNLLAEENYTKQTRIAKSIFLHPIFQDKYSYLHIKDMDADIALIKLNAPVAINNFV
RPICFPAANDTFNEFNSCKISGWGRTAGQPSHILRYADVPILNQKLCNSTHSYNGQITSN
MLCAGYMQGYTDACYGDSGGPLSCKHRPDAVPSAYSNRWYLAGVISGGQGCGQKYYPGIY
TSVTTIPIYKWLSKILENN
Download sequence
Identical sequences B3RNP0
10228.JGI53235 jgi|Triad1|53235|fgeneshTA2_pg.C_scaffold_2000392 XP_002109326.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]