SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI53247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI53247
Domain Number 1 Region: 163-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-16
Family MAM domain 0.025
Further Details:      
 
Domain Number 2 Region: 80-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  10228.JGI53247
Domain Number - Region: 5-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00177
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI53247
Sequence length 339
Comment (Trichoplax adhaerens)
Sequence
MNGKHPTGRCHLNPCINGKCVIRSSGSFYCQCQYGLPKNHAIQQLINVFRIHVIRDGVLT
IKINMYVCSQGMTGTNCDQDINECLSNNGGCIHFCNNTYSSYFCSCPNNQLIGINGRTCD
EPCLASSVPLNDTAAQMKSPTIFQVATVTNQCQLAYSNSLDTSKYSCACETVTCEWIVNG
ACDGRNCTNWKRWKGPIPTGGTGPRADHTRGNSSERTGSRAKTYILNLTGYHIYAEVSAP
RKTGDQFIFDSPNFVTTYPICFTFWFNIYGYGVGELLLLDNRVKIASLIENYGLAWGQVK
TTLKTGHHQLKFIAYRGYGVLGDIAIDDIATLPGPSSKY
Download sequence
Identical sequences B3RNQ2
10228.JGI53247 XP_002109335.1.101920 jgi|Triad1|53247|fgeneshTA2_pg.C_scaffold_2000404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]