SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI5330 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI5330
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily POZ domain 1.59e-30
Family BTB/POZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI5330
Sequence length 238
Comment (Trichoplax adhaerens)
Sequence
ELYAEGTFSDVTIHTNDTVLHCHRFILAAFSDYFRAMFTNGMAESQQRKIELRHVDGKTM
TSIIDYFYGGSLKITSENVQNIAITSSMFNVSEIVDYCCTFLADSLSYTNCVQILIFAEL
YNFHPLTQIANNYILDYFEKCTGYDTFYEIPYPLLNKILPSERLAVKNELTVLNTLKKWV
ELDPSIRKDHLVGLLSHVRLAMIPVEQLIDFEEKETLLKESLPCFQMLLEAKNFHYLP
Download sequence
Identical sequences B3RQ75
XP_002110137.1.101920 10228.JGI5330 jgi|Triad1|5330|gw1.2.491.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]