SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI5393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI5393
Domain Number 1 Region: 4-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-35
Family SPRY domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI5393
Sequence length 172
Comment (Trichoplax adhaerens)
Sequence
EIIHSWHPADHSKNIYIKDDDPLTFYRRPARRSTDAIRGRYGYTHGHHAWKLKWLTPRGS
HAVAGVGSKEAILHCKGYTTLIEQDPNAWGWDITNKISYSAGKKSLTCYPSMALDYQAPS
EVIVYLDMENGTLAFEAEGKYLGICCTGLVGKSLYPMVSEVYGNAEVSIIYL
Download sequence
Identical sequences B3RYH0
XP_002112928.1.101920 jgi|Triad1|5393|gw1.5.395.1 10228.JGI5393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]