SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI5406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI5406
Domain Number 1 Region: 62-78,114-242
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-17
Family Laminin G-like module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI5406
Sequence length 245
Comment (Trichoplax adhaerens)
Sequence
SIGQAAALADISQSCSQTVTYRCMKSVLLNTPNTPYGWWVSRNDEKIVSWGGAPTNSMKC
SCGVTNSCYNRTKMCNCDANHDSVRDDSGALTDKSRLPVKQLKFGYEDIGSNPLALYSLG
KLNCRNRANPKHVITFTTRESTVQFPTWQAEFNGYIELAFRSSISNGVLLKNTGRYGSFI
RLAVQPKLITLNYNLGQGGGNQVLQVKAVGNTGFDDNEWHRIRLSCALYRTSLKVDDQPE
ATNSS
Download sequence
Identical sequences B3S8J9
XP_002116541.1.101920 jgi|Triad1|5406|gw1.16.91.1 10228.JGI5406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]