SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI54446 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI54446
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-30
Family MAM domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI54446
Sequence length 167
Comment (Trichoplax adhaerens)
Sequence
MGSLGCTFESGFCNWKKPIGATDEWRRHSGPSPSRLALPSVDHTYQNVSGYYLYAKTSIK
SEGSSIIVESPVFYSDSAFCLSFWYNGNGKPIGPFIVYDYFNVIYNISGNSESVWYPVKL
DISSGFNKIKFVGVKGKYSNGDIALDDIAAVPGRCSKPMIVTAFIKI
Download sequence
Identical sequences B3RS20
jgi|Triad1|54446|fgeneshTA2_pg.C_scaffold_3000453 10228.JGI54446 XP_002110441.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]