SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI54593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI54593
Domain Number 1 Region: 17-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-24
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI54593
Sequence length 196
Comment (Trichoplax adhaerens)
Sequence
MAQFQGNTGDTFKRNTNFTRSQRPRTIDKQEQKKIYVGWANTYLAQREFPELINDLQKDI
NKGLILINLMESIVGERIPHVCRNPYYQNQKLANVINCLKYLNKKGIAIHYGIATDIVNG
DLKAILSLFFSLTQLEHQIKLQKSKQKAINDNDEQRMASNSYNSLSLRRAYIKDVYILYK
KNLISTLYDANPNQFK
Download sequence
Identical sequences B3RSH0
jgi|Triad1|54593|fgeneshTA2_pg.C_scaffold_3000600 10228.JGI54593 XP_002111051.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]