SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI54934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI54934
Domain Number 1 Region: 201-389
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-45
Family Astacin 0.0000508
Further Details:      
 
Domain Number 2 Region: 441-632
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-19
Family Pentraxin (pentaxin) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI54934
Sequence length 657
Comment (Trichoplax adhaerens)
Sequence
MMLKRSSLRVLLVIVLAVVVLTWQDGVEARTGPRPHRKLSNILSKTSHHSWMTSNSFGTK
VLNRYLNYFDDILKAKCITQKGTKFRFSKRWYDFFRRFWRLRKRRQFKFFPHTKFSTNEK
FRNRTFDNFCYGSLLDLSNAEFIYSKIDAGNKKRGRKIKYSLWEGDILIPDTTMDAFLEI
VKKNSSKSGTRADFDIQTGISGSLWTDNIVPYQFASGYSQTDQQNVKAAMQRVESQTCVK
FVPRTTEINHIVINALTGCSSLIGMHSGAQTLSLDNYCASQPGIIEHELAHTLGMHHTHS
RVDRDDYVAVNFSNISPKLLHNFNIYPNVHSDPLSIEYDYFSVMHYSESDHAIDDDIPVI
DPHVEQASIGQRDGSSYLDYVTINQMYDCYDKTPHYWPMDEIDETNGYILGSDLIYPPPA
STRSSEYLLGLDVGYKLSALRVRGADSFADIGSYPNKCVVDPEFCSNGLTVAFWYKFDTA
TLPTPTYLISTMNENLLIDADRGYEIVVNRAFNDKLLFRISIVQQTTCYIGSTLPFGDYI
NDNWGHFAFTWDATIGVQMYVDGVSQGFSVPCGILGSSFSVDEKNPSLIIGKPASLPDNQ
YNTDFYMDDLVIWEKSLSSNEINSIRNGGPYHDMPSNVGSLGRREIVIGTVAGYTEL
Download sequence
Identical sequences B3RTE3
jgi|Triad1|54934|fgeneshTA2_pg.C_scaffold_3000941 XP_002110676.1.101920 10228.JGI54934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]