SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI54935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI54935
Domain Number 1 Region: 187-366
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-43
Family Astacin 0.0000985
Further Details:      
 
Domain Number 2 Region: 367-594
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-19
Family Pentraxin (pentaxin) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI54935
Sequence length 622
Comment (Trichoplax adhaerens)
Sequence
MVTKSRFLYFWSCLTICTLHTEVYATTASTSSTTTKSTSTLRGTATPLFLNPDDLSAITG
HKPLSEMDSIYSSMGKDMAYKDYLMQLNSQRQISIYKHIEYSTNQTYRDQFRNTYSADAN
IDVVTENRPFTSIISDINSQLGLKDHLLESDILVPNSIFNNRSYDQGTIRKRYLPSGGIA
GQIWGLMVPYKFIPGYSSGDKQKVLDAMDKIKTATCIDFHVKSGGDSDYLDITNVVGCSS
AVGKHGGAQVLSLASTCVSEEGIILHELLHALGIHHTQSRLDRDNYISINTNNVAQGDLP
NFDIYPNQHTDPYSVEYDYQSVMHYGEDDFSTGGTVITPLATGASIGQRNGLSYLDKVTL
NLLYGCYDKTPHYWPMDEIDTTNDLVVGTTDVTGPTFSSDPQFLTGLDGGYHLNALRIRS
EDGYANLGSHPNKCLVDPERCNNGFTLLFWLKIEDRHLYKQHIISSLDRSSEDRGFEIQF
DSLPLIGRFLEIHVQQEDQHDILPIFNDYKYWNHIAVTWSTTNGIKSYVNGTVNNIPAIQ
IPNGMSIDDNKPSLIIGKSPDLNGSDDADFLIDDVVFWEKEISVAEICNIRDNGPYHDIP
SGEGSHGRRATTIGTLTSYVGL
Download sequence
Identical sequences B3RTE4
10228.JGI54935 XP_002110677.1.101920 jgi|Triad1|54935|fgeneshTA2_pg.C_scaffold_3000942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]