SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI55836 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI55836
Domain Number 1 Region: 14-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.53e-32
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI55836
Sequence length 1228
Comment (Trichoplax adhaerens)
Sequence
MANTRPKKYQTLTEVYLTWANFHLANRDLKIKKIQHDFCDGILLCHLIELTSNHQLLHKV
QQSQSVMSQINNVAILLEFMKNCGIKLTTKPEDIVKGDIRSILSILWAIFIHFDVHGNDS
TTYLRTTAQAMKKLTKWCRDQLNITDKLDMKRTPFVKCYQDGKLLAGVIQKYCKLPSSTA
DSYGGSPNDKLRHFTSVIEAAENQLGIPNNLIRPSDILQGKADEHILLIFLALLKHRVEE
DNLTKEKQVKDSIAEGRNKYEIKTRNNSSWTELNHLTKPLRNQLKTTSAPSKVKMNDINK
DEVTSEALKTLHQRIHFYKDARLETFQKSNQDSHSKPYGERTPMSEPAQAVKSADNNDDE
QALASKINGHANQLSQYQNMADSKVDSSYPLLNRVGQDGSNEPNGTSTLHDSHHDSRYLI
ENESRKVQQELEKLEKQLHASKQRFNQPDSVTELLISSQELDLELNDRIQNHQLYENNVE
VKPVDNRQHLESTAIIENNTSIGYDKLQPLSTLNQYHGKLELQHQFDEQQIELIKVKKEK
EDWIAKQSQLEQRIQRLNQQLGSEKEIQLELGKQNILLKEKLIKLEENLQRCTQQNRQNQ
DFEVDKIRDEWEMMKKNKDFYEDQIQRLVRENTILQTKLDDFHVVKQELMEVQQDFKVTI
TDKMAKLQQENDQLREALHEVESLRHEGMQFKVQLNEILQENNQLHQQLDSAEQMQSYVS
QIKDELDQLELENGQLHRKNQLLFDHQNDGENNVAPIQSSTVATTLDPNLNHQDLEPTDS
LPSSPVNHSHLVNGQGNDDNHFNQTLDTDLSTLSRESTKLKEIEIRLDDLRRENKLLSGS
LRDTEVAFHSLTNSFNMDDQAPSNAIGPSSTTTQDTYQAANLHLPMVEKHDPAPSSIMTA
KIEESEMNSITNGNDPVRTTHVEYFSSQQYHHNPFISIKNDNHHLHNRDISHANFNEGKN
TLPDGKGSLSEKSVEYNSNQYGNPFLNTHANGYRDNQSHQDDSITKNDHLLNMGENQEAI
ATNPTSVVQSHANYDSGHFSASYNGHRTNTIHGNRSLGRDREDYNHQPNMDVIKQPTNHS
LPSTLNHEYRLAKMPGNDLQPAKNKSTVITTTTTSNGSFDREEVAKQPFRMEIKVQQEKS
NGDVYGGSCTSSFNNENVSSRISVFSEDSYMEFATTTRNQGKGIPAGHHPRSAIPSHQPQ
QGRDRKYMDNYYNHGHDSFDSILTDAKL
Download sequence
Identical sequences B3RW00
jgi|Triad1|55836|fgeneshTA2_pg.C_scaffold_4000727 10228.JGI55836 XP_002112122.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]