SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI57010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI57010
Domain Number 1 Region: 11-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-43
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI57010
Sequence length 178
Comment (Trichoplax adhaerens)
Sequence
MANSGQYSRERKISNQYDPEQEEYIRKWIEDVIGESLPNGKFSVVLKDGVILCNLINKLS
PGSITKINNTKMPFKQMENIAKFIEATNKYGVPSRDLFQTVDLYEARNMIQVLRSLEALG
RQAQKLGYDGPTIGAKMATENRRSFTEEQLKQSDAVISLQYGTNKGANQSGMRFPSAA
Download sequence
Identical sequences B3RX63
jgi|Triad1|57010|fgeneshTA2_pg.C_scaffold_5000904 10228.JGI57010 XP_002113142.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]