SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI57060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI57060
Domain Number 1 Region: 321-458
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-32
Family Ribonuclease PH domain 1-like 0.00013
Further Details:      
 
Domain Number 2 Region: 50-173
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-30
Family Ribonuclease PH domain 1-like 0.00019
Further Details:      
 
Domain Number 3 Region: 440-543
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-21
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 4 Region: 248-350
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.27e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.001
Further Details:      
 
Domain Number 5 Region: 172-256
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.47e-16
Family Ribonuclease PH domain 2-like 0.0069
Further Details:      
 
Domain Number 6 Region: 537-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 
Domain Number 7 Region: 616-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000129
Family Cold shock DNA-binding domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI57060
Sequence length 741
Comment (Trichoplax adhaerens)
Sequence
MPLSSLSRLANIISYNSQAYRYGLKIHRYCREITRRYNHAHTGCLTTVSGNSEIKFSCGK
LATIADGSVLVETGSTAVLVTAVMSRATTSYAGFAPLRVDYREKASATGKIPVNFFKREL
GPSEREILASRSIDRSIRSSFQRGMPQEVQIVCSLMSADAERDTIVPAINGGAVRVGYIN
DEVIINPTRVELYQSKLDLVIVASAKGLVMLEGTASELPDAGVLKAITYGLEEAQNVVKA
VEDFGHRYGKDKTNLTFYRLDESIKEGAYNLIGDQINDIMLDFSHKKLSRDRAARKVVDE
NFKTLQEMFPNADNFQLSDSFSSVTKRCITQNVMTKSIRCDGRGLNDLRPIDAEINIFPA
LHGSSLFKRGESQFPPYANNEIGRVMENSRREIGHGTLAKNALRSVVSDDFPFTVRLTGQ
VLMSNGSTSMASACGGSLALMDAGVPISRHIAGVAMGLVANPSDDGSKFNYKILTDIAGI
EDYFGEMDFKIAGSREGITSLQADFKVTGVSMELIEEAIKKSAVARGKVLDIMYGVIDKP
RLDVKSSAPVFDIVDVPAGKRFSIVGLGGVTIKGLQEEYGCDINFVDEDKVSIYAPSAKA
LANVKQRIEELMADLKEPDLKFSQIYTGKIVDIKNFGVMLEMEPNTQPILLHVSQLDHRR
VSRPELLGYSIGHEMTVKCFGRDPITNRYRLSRKALLPALSSSIFPPNSSTDPKKKETPS
KDDIKGMEELIGSHSEHEQEQ
Download sequence
Identical sequences B3S0I5
XP_002113540.1.101920 jgi|Triad1|57060|fgeneshTA2_pg.C_scaffold_6000040 10228.JGI57060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]