SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI57624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI57624
Domain Number 1 Region: 295-452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-17
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 2 Region: 512-659
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.11e-16
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 95-156,202-262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000947
Family I set domains 0.0088
Further Details:      
 
Domain Number 4 Region: 9-86
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000138
Family I set domains 0.039
Further Details:      
 
Domain Number 5 Region: 467-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000872
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI57624
Sequence length 673
Comment (Trichoplax adhaerens)
Sequence
MSFYQANSGIVYARKGQRLEFACFSESSQNIPKWATKSDTKFPSGVFQDQQGRLIFPANT
ECHSGIYTCQLSNQDGSVSKNVILVVDLSKHVDVDVQPKSAKVLRGGTAILFSNINGTQS
KECEWTRMGAGLPYHHQTYGPFLILRNVQKSGEYYTSTVSNNDGIGQDSVQLHVDDYPSA
KISPSNRIALRLLKSETKDVSCNGAGKPAPSVTWIKVGGSIDQSLVSGVSLKFRNPKQEM
AGIYECHVSNAYGNVSARLQVDIAVTSILPGFDNSNPNNAAYGAFIGSALRPSDYHEINI
KIKPTKVHDGLIIFQSNGFAENTPSTMHYISLGVKDRHITFYYSSGPQSSPAGISGKVVY
PLIIQEGKWYHIVAKYERGWSSVVVNGGTPAFTFGSFLGKSTTIDLSSWIFLAGLSDLSL
NPLFEVPYGFSGCISQLSFNNKQIDLSKPVESRQMDKCGAACEGDQVCRNGGTCQKFAQD
ESYFTCRCRDKYYGNYCEKMYSATTNPCSRSPCLNNGRCIANGKQHYCLCPMPYYGLSDC
GEVKQLNANDIPYFQKYSYLLYSVNIINEYQQIQFEFNALNLEGALYWIGQKSEGKYLYI
ALIKSRLELRLHVNGRENYLISSQNIVTGKYYQVNVTRSYSSIKMFVDNFEAQLSKSSNL
GPSRLKYLSDGWL
Download sequence
Identical sequences B3RZZ1
jgi|Triad1|57624|fgeneshTA2_pg.C_scaffold_6000604 XP_002113824.1.101920 10228.JGI57624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]