SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI5788 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI5788
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-25
Family Chaperone J-domain 0.00034
Further Details:      
 
Weak hits

Sequence:  10228.JGI5788
Domain Number - Region: 146-193
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0272
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI5788
Sequence length 199
Comment (Trichoplax adhaerens)
Sequence
MRCYYEVLGVERTATTQELKKAYRKLALKYHPDKNINQAEEYTQLFTEILRAYEVLSDPH
ERAWYYVLSLIPFLVLHVIGEDYVHDSLNLMQFFKSSAYNGYGDDEKGFYAVFQYVFETI
AKEEEPYKESEESAPSFGFSNSDYDEVVRVFYAYWQSYSSAFSFVWLEEYDTRQAPNRRT
QRLMEKENKKLRDAARKER
Download sequence
Identical sequences B3S935
10228.JGI5788 XP_002116742.1.101920 jgi|Triad1|5788|gw1.17.111.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]