SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI57909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI57909
Domain Number - Region: 61-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0348
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI57909
Sequence length 159
Comment (Trichoplax adhaerens)
Sequence
MALIRYFALLSILIAIVIGCQPPDCKNVDCGTCGNACCTLMWSFTPGKSAADKIYQLMVT
NFMKGGADHRYKFVKGSNLTTFKNPENVQYLLQAIHRTKVHKYNDTLNIAIYKMDNSTSV
AKGFSISQIAGAYCDHGQNYKNLVGFVKGLGTEYNTNRE
Download sequence
Identical sequences B3S233
XP_002114272.1.101920 10228.JGI57909 jgi|Triad1|57909|fgeneshTA2_pg.C_scaffold_7000127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]