SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI58054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI58054
Domain Number 1 Region: 69-161,227-328
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-30
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI58054
Sequence length 1149
Comment (Trichoplax adhaerens)
Sequence
MDGASSTGIVTNGGIGGMNSGSTGGGINNANFAASSLPHLQYYYGSTGKLPDSDGSTAAS
IEQDKQECMKWINSYISKTGHPLIVNLEEQLSDGLTLIKLLEALAGERLAKYYTLPKLRV
QKIENTKECINFMAERGINVTGIRAEGMIIYNILILKFGLPGVFVIELASGNVKTMLTMC
HLLRLRVEANVKNGYPPLYKPPSAGISNSYINSSQSNLAGSQADLTTLDKEDLSVLSWVT
GLTGIPIQSYNQFYDGRILYEVVSKICGTSIPKEKLDILTPIERCNLAFDTAERELSIPK
QVNSWDVTSGHDNYGVILYLKQLYQVYEHRIRQQDVAQLIEEEARQQRMLDERIRKLKED
EVQLTKHRDEVLQNEQKINDLAESVKQRELNLRQQESEESERIKRQMNEYTNDIMNRQVE
QQLYNESKQVHHDVDRQLEQQGMAATYQWRSSRQNLNHIDGDRNPNHDEHDQYAVHLMKQ
RRRRQLGELELQKKQLEREWKVVEQNQQDLQRQWYQMQEQHNQITHQLTERQLELQRQQE
QLGEKDLELKKRDQEQVLYNQQQQHYWRQKEEQLQQQAAAVEQKANQLQLLQKEVDMQQK
YLTQEKSYVDQRAQQELLEAREKIENEKLNIKKQRDELVKIQHDIEERSRDLMHKKYEIQ
FNEQEETVRLRKRIEDIEKVVQQQHDQLLTEQKKRNDQYEEILELRRQLRLKEQQLDNER
NLREKEIKVKEDELSGLEKQRQQEFIKRMEELRMKETRIEHQRLDYEKQLRTMEEKVKSE
ELLEQERRRQEQEKRLEELKMKEKLLEEEKLERERQLRLQEEKRKEEEILELERKRRLDH
ERRLQEKQELEERIRNIERLQQEVREKQVHQQAQDTTARKSPLIPERPLNYDSSNQRRPL
NNALKPTVSESVLNSPTKSDYRAKSPSAWNASESMVALRTSSPNKSSNDTLSKSRLPMTK
LGGSTSNLSNIGKSPSNVKTRDRYVEPKRFYENATTPAGVNRPSYVGPTKPSPKSQTTPP
SMPSTSPPLPLPKTPEPALIRSKVNDVDANRSSASPTKTPLSSYTSPFVQGRVNAFARSN
EMKAKYPNLPSTPVQKAKETKPQQSTPLSQQRSTSSASVKSPSNSKRAEATQLVRRGART
PGGASTFDF
Download sequence
Identical sequences B3S2K1
XP_002114345.1.101920 10228.JGI58054 jgi|Triad1|58054|fgeneshTA2_pg.C_scaffold_7000272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]