SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10228.JGI58131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI58131
Domain Number 1 Region: 576-617,751-803,846-869,907-958
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000019
Family Nucleotide and nucleoside kinases 0.0053
Further Details:      
 
Domain Number 2 Region: 1625-1763
Classification Level Classification E-value
Superfamily EF-hand 0.0000441
Family Calmodulin-like 0.032
Further Details:      
 
Weak hits

Sequence:  10228.JGI58131
Domain Number - Region: 4-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0168
Family Calponin-homology domain, CH-domain 0.0092
Further Details:      
 
Domain Number - Region: 100-140
Classification Level Classification E-value
Superfamily Hypothetical protein TT1725 0.0615
Family Hypothetical protein TT1725 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI58131
Sequence length 1967
Comment (Trichoplax adhaerens)
Sequence
MTAILCKWLNEDVHLEREITSDNFEAEFANGYLIGQVLNKYSLQSDFGSFSKGSTSESKL
NNFMLIEPTLALLDIPFNTATAKDIMYKKHGVAVRLLYELYIALNNKEKRKLTGTAMQTM
KARANVALASVGSIEFKRRLTGETTRQSSLNLREIENRYNDKKKQLQDQAFKKKFLEEEQ
WRQEKEQQRQQELAKFRNLRQQQTEVLSRIRAAAVRIPKPPSTKKANGMSPVEMRKTQDE
TVVKEEIEKFENSIRNVAMPSSPLLVDFDVDMMLNDDGKPKNKLDPINIVQPNEATEYVT
GIKRRVKDDLNAKEERQKRRRRVLLEQMKAYHMQEEAHHEDILVNRLMRQSQHERKIAVQ
LMHERHLKEVIVNNRIERENEYTQRRLKDFDDALNREAKYAELARLQYQEELKKEKALHQ
QILNERAERKYQKHYSMCMEIMNQIVDFSVRIGQYRELTENKLPSKLLSEWKTLFTVGIP
LFDDQPEAEEDDKAEEADVTNILHEERQALLDEADFMEYNNGVGEWNPPENFDYQFPPKD
NSILGHIVKTLFNTVAPPEPPVDAPEFPEFPIKACFLGKQFSGKSVTIDRLLENHRIKVI
ELDNLIHEAVDAFERGELDESKIQSETNEDEGALGENEMKKDNESSTNLNTTGQGSEQEG
DGSKTTMQSSTSLSGIPNEDSKSKGGNLKHSGGSTYIGKAAKQSYDGSNGHLGPVQETEH
KPSNDGKRRGSIMSFRASDIENYSPRAKLGFKAAKALKRGKAVDDQVMVDIITNTIKKIP
QGSGWILDDFPSTYNQAKLFEKALTGYDPSPPQVKTISQAKGGSKARKKSLLAPDPKPEE
KLPPPVSGIDVVILFDVKDEVVLKRATGRTKTMTSSKQYHEEFNPPPEGSRTGLNKQDKV
MPVSDANYASEHVQQRLVGFHDTWSKLEKWFTKFGNLKKIDGAEDQETVFQNVETILEEV
LEKLKPEPEPEPSSGVAERSLSPQQPLDLNLHPVQDASLIPENKDTPLAETPKVVVDTPN
LIAVIENESKAQTEKEKNKHHPIKSEDSKDVSPRIKEKGKKFKKKSDARRRSSAMAEPVI
QEQSLVRQGEAEDLNKVEEEEERPPSPPKPEPGSEDWIYVENTIELELATILSSQWENIE
INYIDSCKYIFRKMRDERESTYQYFYNIRNEYKEFLRRPDLKQMLVNQWQKEYNDLAEDM
RSDEETKAELHQTVMDLAEKLWNMCDKRKEDAERERDNIMKDGWLEDRVGLTTNYYITLM
QAELDRVQDTCFLLKDYYMSAAGKILIEFAVPNGRLPLLELATVESSSVVVLKGTIETNS
VSVQSSTGKSTSAKESVVKESRGKDRGKDRDRERDKDKEKEKDAAERGISALTSAMNHED
TEDGKTKIPLIPRRPKSAEQSKDGQSGSKEKREKKSKKEKQEEKVDSPSLHMDPDEKVIN
DAYNIVQEYVLMMISAELTATAAEAEKEREREHERQRDLEKAAKTKKKHKKEKVVKGRHK
KQQIVVEEPVEEPPEQTAEEKEQIAIREKIREEFTAATKAEEIRLRSRLELIRSRAICDI
QVIKHKAEVMYKDMDDWLGQRFRKEMESIKELTTMMRAAIESEEKIQNELKLVNDNFFID
ENVMMYNIPEPPPPPSPIESSMPENFTVVQILNLAHQLSAIASNGYISKQAFIDLLHGTI
SLSHGQETLPDKWMLLNQTQLNDMANLVSLDKEYINWRIFLVAIMNPVPWPSRDQLLDTL
KKFRQVDTDHTGFVTKAQYEKIELWFKGSPPSNQSPSLPRQYDRLGKLKEAFFDIFGHNN
TSTLLLDYVDMLLYFCQARRHDIGLMRALSVTSSQPMPYISIRELTDDGLKTENEEKSTE
SSLHTVIEEKEEEEESESATHNNAMIPVEALVKVLNHGTYFKKKSNRFELSTTDNCTLTT
SYVSDLYQELGSSTASPLPFDTIFSHPILHNAIKACKTYKKAVANSL
Download sequence
Identical sequences B3S0Y6
jgi|Triad1|58131|fgeneshTA2_pg.C_scaffold_7000349 10228.JGI58131 XP_002114383.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]